PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3DL_E21790878.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 209aa    MW: 23099.4 Da    PI: 10.3173
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3DL_E21790878.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.17.7e-1395139852
                            HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   8 rrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                             r++kNRe+A  sR+RK+a++ eLe +   L++eN  Lk + +++
  Traes_3DL_E21790878.1  95 HRMIKNRESAGQSRARKQAYTVELEAELNHLKEENAHLKAKEKTI 139
                            69************************************9876665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.4E-987153IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.05990135IPR004827Basic-leucine zipper domain
CDDcd147076.83E-1992146No hitNo description
SuperFamilySSF579596.88E-1094138No hitNo description
PfamPF001702.6E-1095139IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.7E-1295138No hitNo description
PROSITE patternPS00036096110IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MYPMAPANGM FHVMGNGMGF VPNGYAGIVV VPPPPPPQGG LGIVSPGSSD GRSAMTQVDM  60
MNSMGDGAMM ENGSARKRAA PEDQSCERSI ERCHHRMIKN RESAGQSRAR KQAYTVELEA  120
ELNHLKEENA HLKAKEKTIL LTKKQMLVEK MMERSKENMN AKKGGALSRR CGSXXXXXPP  180
FSFHSRAGRR MRMNYGYLSF PERGGIVIY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2389320.0AB238932.1 Triticum aestivum TaABI5 mRNA for bZip type transcription factor TaABI5, complete cds.
GenBankAF5198030.0AF519803.1 Triticum aestivum ABA response element binding factor (ABFA) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628691.14e-72PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7
RefseqXP_015628684.14e-72PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7
TrEMBLW5DEE21e-149W5DEE2_WHEAT; Uncharacterized protein
STRINGMLOC_34679.11e-101(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38303558
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36270.11e-21bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]